PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00047878-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family bZIP
Protein Properties Length: 88aa    MW: 10464.8 Da    PI: 9.5349
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00047878-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_124.65.4e-0829721861
                      HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1 18 rrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61
                      ++ R+RKka+   Le++vk +e +N +L ++l++l+++ + l++
  PSME_00047878-RA 29 QKARERKKAYSNYLETRVKDIELKNYELEERLSTLQNKNQMLRQ 72
                      799***********************************998876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF579596.88E-82875No hitNo description
PfamPF001702.0E-62973IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1708.4E-92976No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 88 aa     Download sequence    Send to blast
MREPETHHFH CYPQEERESP CRQGTHVSQK ARERKKAYSN YLETRVKDIE LKNYELEERL  60
STLQNKNQML RQVLKNTTMK NGSGNLGT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011026460.11e-21PREDICTED: transcription factor HY5-like isoform X1
RefseqXP_011026461.16e-22PREDICTED: transcription factor HY5-like isoform X2
SwissprotO246462e-19HY5_ARATH; Transcription factor HY5
TrEMBLA9NTI78e-23A9NTI7_PICSI; Putative uncharacterized protein
STRINGPOPTR_0018s01530.18e-21(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11260.11e-20bZIP family protein